THAP7 polyclonal antibody
  • THAP7 polyclonal antibody

THAP7 polyclonal antibody

Ref: AB-PAB20159
THAP7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THAP7.
Información adicional
Size 100 uL
Gene Name THAP7
Gene Alias MGC10963
Gene Description THAP domain containing 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEYIYFCSKHFEEDCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPPEVSRLRRCRKRCSEGRGPTTPFSPPPPADVTCFP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human THAP7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80764
Iso type IgG

Enviar uma mensagem


THAP7 polyclonal antibody

THAP7 polyclonal antibody