MLC1 polyclonal antibody
  • MLC1 polyclonal antibody

MLC1 polyclonal antibody

Ref: AB-PAB20155
MLC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MLC1.
Información adicional
Size 100 uL
Gene Name MLC1
Gene Alias KIAA0027|LVM|MLC|VL
Gene Description megalencephalic leukoencephalopathy with subcortical cysts 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MLC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23209
Iso type IgG

Enviar uma mensagem


MLC1 polyclonal antibody

MLC1 polyclonal antibody