ELP2 polyclonal antibody
  • ELP2 polyclonal antibody

ELP2 polyclonal antibody

Ref: AB-PAB20148
ELP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ELP2.
Información adicional
Size 100 uL
Gene Name ELP2
Gene Alias FLJ10879|SHINC-2|STATIP1|StIP
Gene Description elongation protein 2 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ECDSTDDCIEHNIGPCSSVLDVGGAVTAVSVCPVLHPSQRYVVAVGLECGKICLYTWKKTDQVPEINDWTHCVETSQSQSHTLAIRKLCWKNCSGKTEQKEAEGAEWLHFASCGEDHTVKIHRVNKCA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ELP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55250
Iso type IgG

Enviar uma mensagem


ELP2 polyclonal antibody

ELP2 polyclonal antibody