SRRD polyclonal antibody
  • SRRD polyclonal antibody

SRRD polyclonal antibody

Ref: AB-PAB20142
SRRD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SRRD.
Información adicional
Size 100 uL
Gene Name SRRD
Gene Alias HC/HCC|SRR1L
Gene Description SRR1 domain containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AEKDLFISDFWSSALETINRCLTKHLEQLKAPVGTLSDIFGNLHLDSLPEESDVATDSIPREILVTGTCHLKCVCYGIGNFATCIVARNQLTFLLLLLEKCQIPRSHCWVYDPLFSQLEIEVLNTLGVTVLSENEEGKRSI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SRRD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 402055
Iso type IgG

Enviar uma mensagem


SRRD polyclonal antibody

SRRD polyclonal antibody