CECR2 polyclonal antibody
  • CECR2 polyclonal antibody

CECR2 polyclonal antibody

Ref: AB-PAB20141
CECR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CECR2.
Información adicional
Size 100 uL
Gene Name CECR2
Gene Alias KIAA1740
Gene Description cat eye syndrome chromosome region, candidate 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TLGHVMDSRVMRPPVPPNQWTEQSGFLPHGVPSSGYMRPPCKSAGHRLQPPPVPAPSSLFGAPAQALRGVQGGDSMMDSPEMIAMQQLSSRVCPPGVPYHPHQPAHPRLPGPFPQVAHPMSVTVSAPKPALGNPGRAPENSEAQEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CECR2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27443
Iso type IgG

Enviar uma mensagem


CECR2 polyclonal antibody

CECR2 polyclonal antibody