EAPP polyclonal antibody
  • EAPP polyclonal antibody

EAPP polyclonal antibody

Ref: AB-PAB20139
EAPP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EAPP.
Información adicional
Size 100 uL
Gene Name EAPP
Gene Alias BM036|C14orf11|FLJ20578|MGC4957
Gene Description E2F-associated phosphoprotein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VLLHGTPDQKRKLIRECLTGESESSSEDEFEKEMEAELNSTMKTMEDKLSSLGTGSSSGNGKVATAPTRYYDDIYFDSDSEDEDRAVQVTKKKKKKQHKIPTNDELLYDPE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EAPP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55837
Iso type IgG

Enviar uma mensagem


EAPP polyclonal antibody

EAPP polyclonal antibody