NPAS3 polyclonal antibody
  • NPAS3 polyclonal antibody

NPAS3 polyclonal antibody

Ref: AB-PAB20136
NPAS3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NPAS3.
Información adicional
Size 100 uL
Gene Name NPAS3
Gene Alias MOP6|PASD6|bHLHe12
Gene Description neuronal PAS domain protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSETPEPVESTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NPAS3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64067
Iso type IgG

Enviar uma mensagem


NPAS3 polyclonal antibody

NPAS3 polyclonal antibody