PGRMC1 polyclonal antibody
  • PGRMC1 polyclonal antibody

PGRMC1 polyclonal antibody

Ref: AB-PAB20135
PGRMC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PGRMC1.
Información adicional
Size 100 uL
Gene Name PGRMC1
Gene Alias HPR6.6|MPR
Gene Description progesterone receptor membrane component 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PGRMC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10857
Iso type IgG

Enviar uma mensagem


PGRMC1 polyclonal antibody

PGRMC1 polyclonal antibody