CXorf36 polyclonal antibody
  • CXorf36 polyclonal antibody

CXorf36 polyclonal antibody

Ref: AB-PAB20132
CXorf36 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CXorf36.
Información adicional
Size 100 uL
Gene Name CXorf36
Gene Alias 4930578C19Rik|DKFZp313K0825|EPQL1862|FLJ14103|PRO3743|bA435K1.1
Gene Description chromosome X open reading frame 36
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLPASSLSSLVPQVRTSYNFGRTFLGLDKCNACIGTSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPANYSDDSKIWRPVEIFRLVSKYQNEISDRRICASASAPKTCSIERVLRKTERFQKWLQAKRLTPDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CXorf36.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79742
Iso type IgG

Enviar uma mensagem


CXorf36 polyclonal antibody

CXorf36 polyclonal antibody