NAB1 polyclonal antibody
  • NAB1 polyclonal antibody

NAB1 polyclonal antibody

Ref: AB-PAB20131
NAB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NAB1.
Información adicional
Size 100 uL
Gene Name NAB1
Gene Alias -
Gene Description NGFI-A binding protein 1 (EGR1 binding protein 1)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MIGHIFEMNDDDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFALARQISREVTYKYTYRTTKSKCGERDELSPKRIKVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NAB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4664
Iso type IgG

Enviar uma mensagem


NAB1 polyclonal antibody

NAB1 polyclonal antibody