SSRP1 polyclonal antibody
  • SSRP1 polyclonal antibody

SSRP1 polyclonal antibody

Ref: AB-PAB20128
SSRP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SSRP1.
Información adicional
Size 100 uL
Gene Name SSRP1
Gene Alias FACT|FACT80|T160
Gene Description structure specific recognition protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SSRP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6749
Iso type IgG

Enviar uma mensagem


SSRP1 polyclonal antibody

SSRP1 polyclonal antibody