RPL27 polyclonal antibody
  • RPL27 polyclonal antibody

RPL27 polyclonal antibody

Ref: AB-PAB20126
RPL27 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPL27.
Información adicional
Size 100 uL
Gene Name RPL27
Gene Alias -
Gene Description ribosomal protein L27
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq GKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPL27.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6155
Iso type IgG

Enviar uma mensagem


RPL27 polyclonal antibody

RPL27 polyclonal antibody