TRIP11 polyclonal antibody
  • TRIP11 polyclonal antibody

TRIP11 polyclonal antibody

Ref: AB-PAB20125
TRIP11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRIP11.
Información adicional
Size 100 uL
Gene Name TRIP11
Gene Alias CEV14|GMAP-210|TRIP230
Gene Description thyroid hormone receptor interactor 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSENERLKKLCTDLEEKHEASEIQIKQQSTSYRNQLQQKEVEISHLKARQIALQDQLLKLQSAAQSVPSGAGVPATTASSSFAY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRIP11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9321
Iso type IgG

Enviar uma mensagem


TRIP11 polyclonal antibody

TRIP11 polyclonal antibody