SLC2A1 polyclonal antibody
  • SLC2A1 polyclonal antibody

SLC2A1 polyclonal antibody

Ref: AB-PAB19764
SLC2A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against full length recombinant SLC2A1.
Información adicional
Size 100 uL
Gene Name SLC2A1
Gene Alias DYT17|DYT18|GLUT|GLUT1|MGC141895|MGC141896|PED
Gene Description solute carrier family 2 (facilitated glucose transporter), member 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity It displayed on membrane surface of lipoparticles.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEPSSKKLTGRLMLAVGGGVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTTLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREK
Form Liquid
Recomended Dilution Western Blot (1:200)
Immunofluorescence (1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to full length human SLC2A1.
Storage Buffer In unpurified whole serum
Gene ID 6513

Enviar uma mensagem


SLC2A1 polyclonal antibody

SLC2A1 polyclonal antibody