GST purified rabbit polyclonal antibody
  • GST purified rabbit polyclonal antibody

GST purified rabbit polyclonal antibody

Ref: AB-PAB1625-E01P
GST purified rabbit polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against GST protein.
Información adicional
Size 100 ug
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV*
Antigen species Target species Human
Quality control testing Antibody reactive against recombinant protein.
Immunogen GST protein. ( 242 a.a protein modified from AAB37352, please see the protein seq for the actual immunogen sequence. )
Storage Buffer In 1x PBS, pH 7.4

Enviar uma mensagem


GST purified rabbit polyclonal antibody

GST purified rabbit polyclonal antibody