PDGFA polyclonal antibody
  • PDGFA polyclonal antibody

PDGFA polyclonal antibody

Ref: AB-PAB16158
PDGFA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against PDGFA.
Información adicional
Size 100 ug
Gene Name PDGFA
Gene Alias PDGF-A|PDGF1
Gene Description platelet-derived growth factor alpha polypeptide
Storage Conditions The lyophilized antibody is stable for at least 1 year from date of receipt at -20C.
After reconstitution with 0.01 M PBS, pH 7.4 or other diluents, this antibody can be stored in working aliquots at 2C- 8C for one month, or at -20C for six months with
Application Key WB,IHC,ELISA
Immunogen Prot. Seq VKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVR
Form Lyophilized
Recomended Dilution ELISA (1-2 ug/mL)
Western Blot (2-10 ug/mL)
Immunohistochemistry (2-10 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Human PDGFA.
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 5154
Iso type IgG

Enviar uma mensagem


PDGFA polyclonal antibody

PDGFA polyclonal antibody