Ift80 polyclonal antibody
  • Ift80 polyclonal antibody

Ift80 polyclonal antibody

Ref: AB-PAB15842
Ift80 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Ift80.
Información adicional
Size 50 ug
Gene Name Ift80
Gene Alias 4921524P20Rik|Wdr56|mKIAA1374
Gene Description intraflagellar transport 80 homolog (Chlamydomonas)
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0752. This antibody detects mIFT80 protein.
Application Key WB
Immunogen Prot. Seq KNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKK
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 134 amino acids of mouse Ift80.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 68259
Iso type IgG

Enviar uma mensagem


Ift80 polyclonal antibody

Ift80 polyclonal antibody