Ndrg2 polyclonal antibody
  • Ndrg2 polyclonal antibody

Ndrg2 polyclonal antibody

Ref: AB-PAB15841
Ndrg2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Ndrg2.
Información adicional
Size 50 ug
Gene Name Ndrg2
Gene Alias AI182517|AU040374|Ndr2|SYLD
Gene Description N-myc downstream regulated gene 2
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX2322. This antibody detects mNDRG2 protein.
Application Key WB
Immunogen Prot. Seq DPNAKGWMDWAAHKLTGLTSSIPDMILGHLFSQEELSGNSELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGGETTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFK
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 137 amino acids of mouse Ndrg2.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 29811

Enviar uma mensagem


Ndrg2 polyclonal antibody

Ndrg2 polyclonal antibody