Myst4 polyclonal antibody
  • Myst4 polyclonal antibody

Myst4 polyclonal antibody

Ref: AB-PAB15811
Myst4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Myst4.
Información adicional
Size 50 ug
Gene Name Myst4
Gene Alias AI507552|B130044K16Rik|KAT6B|Morf|mKIAA0383|qkf|querkopf
Gene Description MYST histone acetyltransferase monocytic leukemia 4
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX1056. This antibody detects mMYST4 protein.
Application Key WB-Ce
Immunogen Prot. Seq QLELSVQDGSVLKVTNKGLASYKDPDNPGRFSSVKPGTFPKPTKGSKGPPCNDLRNVDWNKLLKRAIEGLEEPNGSSLKNIEKYLRSQSDLTGTTNHPAFQQRLRLGAKRAVNNGRLLKEGPQYRVNSGSSDGKGAPQYPSAFPSSLPPVSLLPHEKDQ
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 159 amino acids of mouse Myst4.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 54169

Enviar uma mensagem


Myst4 polyclonal antibody

Myst4 polyclonal antibody