Cnst polyclonal antibody
  • Cnst polyclonal antibody

Cnst polyclonal antibody

Ref: AB-PAB15795
Cnst polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Cnst.
Información adicional
Size 50 ug
Gene Name 9630058J23Rik
Gene Alias MGC31547
Gene Description RIKEN cDNA 9630058J23 gene
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX2268. This antibody detects mC1orf71 protein.
Application Key WB
Immunogen Prot. Seq MAPEERRDSEDRVSKETEDYLHSLLERCLKDAEDSLSYEDIQDDDSDLLQDLSPEEASYSLQEDLPPDESTLSLDDLAKKIEIAEAIPAEGLVSILKKRNDTVGSHPAQMQQKPAKRRVRFQEID
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 125 amino acids of mouse Cnst.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 226744

Enviar uma mensagem


Cnst polyclonal antibody

Cnst polyclonal antibody