Pak4 polyclonal antibody
  • Pak4 polyclonal antibody

Pak4 polyclonal antibody

Ref: AB-PAB15738
Pak4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Pak4.
Información adicional
Size 50 ug
Gene Name Pak4
Gene Alias 5730488L07Rik|AW555722|mKIAA1142
Gene Description p21 (CDKN1A)-activated kinase 4
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0548. This antibody detects mPAK4 protein.
Application Key WB
Immunogen Prot. Seq GFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKASPSLKGFLDRLLVRDPAQRATAAELLKHPFLTKAGPPASIVPLMRQHRTR
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 132 mouse Pak4.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 70584

Enviar uma mensagem


Pak4 polyclonal antibody

Pak4 polyclonal antibody