Ralgapa1 polyclonal antibody
  • Ralgapa1 polyclonal antibody

Ralgapa1 polyclonal antibody

Ref: AB-PAB15730
Ralgapa1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Ralgapa1.
Información adicional
Size 50 ug
Gene Name Garnl1
Gene Alias 2310003F20Rik|4930400K19Rik|AI563624|GRIPE|Tulip1|mKIAA0884
Gene Description GTPase activating RANGAP domain-like 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0664. This antibody detects mGARNL1 protein.
Application Key WB-Re
Immunogen Prot. Seq MRPVDDPGVPSEWTSPASAGSSDLMSSDSHSDSFSAFQCEGRKFDNFGFGTDIGIPSSADVDLGSGHHQSTEEQEVASLTTLHLDSETSSLNQQAFSAEVATVTGSESASPVHSALGSRSQTPSPSTLSRAHIEQKDLQLDEKLHHSVLQTPDDLGNA
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 158 mouse Ralgapa1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 56784

Enviar uma mensagem


Ralgapa1 polyclonal antibody

Ralgapa1 polyclonal antibody