Morc2a polyclonal antibody
  • Morc2a polyclonal antibody

Morc2a polyclonal antibody

Ref: AB-PAB15729
Morc2a polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Morc2a.
Información adicional
Size 50 ug
Gene Name Morc2a
Gene Alias 8430403M08Rik|Zcwcc1
Gene Description microrchidia 2A
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX1256. This antibody detects mMORC2A protein. It also recognizes human MORC2A protein.
Application Key WB
Immunogen Prot. Seq KDKGLHVEVRVNREWYTGRVTAVEVGKNAVRWKVKFDYVPTDTTPRDRWVEKGSEDVRLMKPPSPEHQSPDTQQEGGEEEEAMVARQAVALPEPSTSDGLPIEPDTTATSPSHETIDLLVQILRNCLRYFLPPSFPISKKELSVMNSEELISFPLKEYFKQYEVGLQNLCHSYQSRADSRAKASEESLRTSEKKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIEDLITKGD
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 240 mouse Morc2a.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 74522

Enviar uma mensagem


Morc2a polyclonal antibody

Morc2a polyclonal antibody