Ivns1abp polyclonal antibody
  • Ivns1abp polyclonal antibody

Ivns1abp polyclonal antibody

Ref: AB-PAB15728
Ivns1abp polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Ivns1abp.
Información adicional
Size 50 ug
Gene Name Ivns1abp
Gene Alias 1190004M08Rik|1700126I16Rik|AA960440|HSPC068|ND1|NS-1|NS1-BP|Nd1-L|Nd1-S|mKIAA0850
Gene Description influenza virus NS1A binding protein
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0474. This antibody detects mIVNS1ABP protein. It also recognizes human IVNS1ABP protein.
Application Key WB
Immunogen Prot. Seq SDPYGQKGLKNCDVFDPVTKSWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGITTVGNTIYAVGGFDGNEFLNTVEVYNPQSNEWSPYTKIFQF
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 172 mouse Ivns1abp.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 117198

Enviar uma mensagem


Ivns1abp polyclonal antibody

Ivns1abp polyclonal antibody