Dock4 polyclonal antibody
  • Dock4 polyclonal antibody

Dock4 polyclonal antibody

Ref: AB-PAB15726
Dock4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Dock4.
Información adicional
Size 50 ug
Gene Name Dock4
Gene Alias 5330406C03|6330411N01Rik|AF263288|C030023J22|mKIAA0716
Gene Description dedicator of cytokinesis 4
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0390. This antibody detects mDOCK4 protein.
Application Key WB
Immunogen Prot. Seq CLSPRDRPCSAIYPTPVEPSQRMLFNHIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISPPVPPRPTQTASPARHTTSVSPSPAGRSPLKGSVQSFTPSPVEYNSPGLSSNSPVLSGSYSSGISSLSRCSTSETSGFENQANEQSVPVPVPVPVPVPVPSFSGSEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGTRRTEPGPRPRPLPRKVSQ
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 254 mouse Dock4.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 238130

Enviar uma mensagem


Dock4 polyclonal antibody

Dock4 polyclonal antibody