Kbtbd11 polyclonal antibody
  • Kbtbd11 polyclonal antibody

Kbtbd11 polyclonal antibody

Ref: AB-PAB15725
Kbtbd11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Kbtbd11.
Información adicional
Size 50 ug
Gene Name Kbtbd11
Gene Alias 4930465M17Rik|mKIAA0711
Gene Description kelch repeat and BTB (POZ) domain containing 11
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0626. This antibody detects mKBTBD11 protein.
Application Key WB
Immunogen Prot. Seq LKYDPRRDEWQECPCSSSRERSADMVALDGFLYRFDLCGSRGEAQAAVGSGGGVSVFRYHCLAKQWSQCAVHLRPPGAPAGLQPFRCVALDGTIYCVSRAGTWRFVPSQDTEAGSDMGPGGSFEPEPLGSPLDVRGVLFPFVLNLPEKPDRGEQGAV
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 157 mouse Kbtbd11.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 74901

Enviar uma mensagem


Kbtbd11 polyclonal antibody

Kbtbd11 polyclonal antibody