Cstf2t polyclonal antibody
  • Cstf2t polyclonal antibody

Cstf2t polyclonal antibody

Ref: AB-PAB15724
Cstf2t polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Cstf2t.
Información adicional
Size 50 ug
Gene Name Cstf2t
Gene Alias 64kDa|C77975|tCstF-64|tauCstF-64
Gene Description cleavage stimulation factor, 3' pre-RNA subunit 2, tau
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX1074. This antibody detects mSYNJ1 protein.
Application Key WB
Immunogen Prot. Seq RGGRESRGMETRPMETEVLEPRGMERRMETCAMETRGMDARGLEMRGPGPSSRGPMTGGIQGPGPINMGAGGPQGPRQVPNIAGVGNPGGTMQGAGIQGGGMQGAGMQGGGMQGAGMQGGGMQGAGMQAGMQGASMQGGMQGAGMQGASKQGGGQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 130 mouse Cstf2t.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 83410

Enviar uma mensagem


Cstf2t polyclonal antibody

Cstf2t polyclonal antibody