Dzip3 polyclonal antibody
  • Dzip3 polyclonal antibody

Dzip3 polyclonal antibody

Ref: AB-PAB15723
Dzip3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Dzip3.
Información adicional
Size 50 ug
Gene Name Dzip3
Gene Alias 2310047C04Rik|2A-HUB|6430549P11Rik|A230104G20
Gene Description DAZ interacting protein 3, zinc finger
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0307. This antibody detects mDZIP3 protein. It also recognizes human DZIP3 protein.
Application Key WB
Immunogen Prot. Seq SEPLMINWERITDRLKTAFPQQTRKELTDFLQQLKDSHGKSVSRLTFDEIVYKISQMIEPKKSESEEKSAQDGNNASPSHTASQPNAPQDPKSAQGSATWEGDKDMVRPNLLTVNTFRSERKRMV
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 125 mouse Dzip3.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 224170

Enviar uma mensagem


Dzip3 polyclonal antibody

Dzip3 polyclonal antibody