Kif5c polyclonal antibody
  • Kif5c polyclonal antibody

Kif5c polyclonal antibody

Ref: AB-PAB15721
Kif5c polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Kif5c.
Información adicional
Size 50 ug
Gene Name Kif5c
Gene Alias KINN|Khc|NKHC|NKHC-2|NKHC2|mKIAA0531
Gene Description kinesin family member 5C
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0067. This antibody detects endogenous mKIF5C protein in several cell types. It also recognizes human KIF5C protein.
Application Key WB,IHC-P,IHC-Fr
Immunogen Prot. Seq VKALESALKEAKENAMRDRKRYQQEVDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAVRGGGGGSSNSTHYQK
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 82 mouse Kif5c.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 16574

Enviar uma mensagem


Kif5c polyclonal antibody

Kif5c polyclonal antibody