Zscan12 polyclonal antibody
  • Zscan12 polyclonal antibody

Zscan12 polyclonal antibody

Ref: AB-PAB15718
Zscan12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Zscan12.
Información adicional
Size 50 ug
Gene Name Zscan12
Gene Alias 2510038J07Rik|FPM315|Zfp96|mKIAA0426
Gene Description zinc finger and SCAN domain containing 12
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0926. This antibody detects mZSCAN12.
Application Key WB
Immunogen Prot. Seq PGRKVHGCDECGKSFTQHSRLIEHKRVHTGDRPYKCEVCGKTFRWRTVLIRHKVVHTGEKPYKCNECGRAFGQWSALNQHQRLHSGEKHYHCNECGKAFCQKAGLFHHLKSHRRNRPYQCLQCNKSFNRRSTLSQHQGVHTGAKPYECNDCGKAFVYNSSLATHQETHHKEKPFTQSGPIQQQRNHTKEKPYKCSVCGKAFIQKISLIEHEQIHTGERPYKCAEGGKAFIQMSELTEH
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 238 mouse Zscan12.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 22758

Enviar uma mensagem


Zscan12 polyclonal antibody

Zscan12 polyclonal antibody