Rnmt polyclonal antibody
  • Rnmt polyclonal antibody

Rnmt polyclonal antibody

Ref: AB-PAB15717
Rnmt polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Rnmt.
Información adicional
Size 50 ug
Gene Name Rnmt
Gene Alias 2610002P10Rik|AI848273|mKIAA0398
Gene Description RNA (guanine-7-) methyltransferase
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0826. This antibody detects mRNMT protein. It also recognizes human RNMT protein.
Application Key WB
Immunogen Prot. Seq RLEASETESFGNEIYTVKFQKKGNYPLFGCKYDFNLEGVVDVPEFLVYFPLLTEMAKKYNMKLIYKKTFLEFYEEKIKNNENKMLLKRMQALEQYPAHENSKLASEKVGDYTHAAEYLKKSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 150 mouse Rnmt.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 67897

Enviar uma mensagem


Rnmt polyclonal antibody

Rnmt polyclonal antibody