Rb1cc1 polyclonal antibody
  • Rb1cc1 polyclonal antibody

Rb1cc1 polyclonal antibody

Ref: AB-PAB15711
Rb1cc1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Rb1cc1.
Información adicional
Size 50 ug
Gene Name Rb1cc1
Gene Alias 2900055E04Rik|5930404L04Rik|Cc1|DRAGOU14|FIP200|LaXp180
Gene Description RB1-inducible coiled-coil 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0378. This antibody detects mRB1CC1 protein.
Application Key WB-Re
Immunogen Prot. Seq QRLMSQSLSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 117 mouse Rb1cc1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 12421

Enviar uma mensagem


Rb1cc1 polyclonal antibody

Rb1cc1 polyclonal antibody