Sept8 polyclonal antibody
  • Sept8 polyclonal antibody

Sept8 polyclonal antibody

Ref: AB-PAB15710
Sept8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Sept8.
Información adicional
Size 50 ug
Gene Name Sept8
Gene Alias AW046166|Sepl|mKIAA0202
Gene Description septin 8
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0010. This antibody detects endogenous mSEPT8 protein in several cell types. It also recognizes human SEPT8 protein.
Application Key WB,IHC-P,IHC-Fr
Immunogen Prot. Seq AVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRIHQEEKRKVEEKRRELEEETNAFNCRKAAMEALQSQALHATSQQPLRKDKDKKN
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 192 mouse Sept8.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 20362

Enviar uma mensagem


Sept8 polyclonal antibody

Sept8 polyclonal antibody