Pdcd11 polyclonal antibody
  • Pdcd11 polyclonal antibody

Pdcd11 polyclonal antibody

Ref: AB-PAB15709
Pdcd11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Pdcd11.
Información adicional
Size 50 ug
Gene Name Pdcd11
Gene Alias 1110021I22Rik|ALG-4|Pdcd7|mKIAA0185
Gene Description programmed cell death 11
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0685. This antibody detects mPDCD11 protein. It also recognizes human PDCD11 protein.
Application Key WB
Immunogen Prot. Seq TKSEKYKEAGELYNRMLKRFRQEKAVWIKYGAFVLGRSQAGASHRVLQRALECLPAKEHVDVIVKFAQLEFQLGDVERAKAIFENTLSTYPKRTDVWSVYIDMTIKHGSQTAVRDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKAKALEYVEAKSSALED
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to a 170 amino acid fragment of mouse Pdcd11.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide).
Gene ID 18572

Enviar uma mensagem


Pdcd11 polyclonal antibody

Pdcd11 polyclonal antibody