Scrib polyclonal antibody
  • Scrib polyclonal antibody

Scrib polyclonal antibody

Ref: AB-PAB15708
Scrib polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Scrib.
Información adicional
Size 50 ug
Gene Name Scrib
Gene Alias AI118201|CRIB|Crc|KIAA0147|SCRIB1|Scrb1|mKIAA0147|vartul
Gene Description scribbled homolog (Drosophila)
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0312. This antibody detects mSCRIB protein. It also recognizes human SCRIB protein.
Application Key WB-Tr
Immunogen Prot. Seq ALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLEDFGLQTSASPGRLPLSGKKFDYRAFAALPSSRPVYDIQSPDFVEELRTLEASPSPGSQEEDGEVALVLLGRPSPGAVGPEDMTLCSSRRSVRPGRRGLGPVPS
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 143 mouse Scrib.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 105782

Enviar uma mensagem


Scrib polyclonal antibody

Scrib polyclonal antibody