Dhx34 polyclonal antibody
  • Dhx34 polyclonal antibody

Dhx34 polyclonal antibody

Ref: AB-PAB15707
Dhx34 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Dhx34.
Información adicional
Size 50 ug
Gene Name Dhx34
Gene Alias 1200013B07Rik|1810012L18Rik|Ddx34|mKIAA0134
Gene Description DEAH (Asp-Glu-Ala-His) box polypeptide 34
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0622. This antibody detects mDHX34 protein.
Application Key WB
Immunogen Prot. Seq GPQTITTAPSLPGLFGNSTLSPHPTKGGYAVSDYLTYNCLTSDTDLYSDCLRSFWTCPHCGLHMPFTPLERIAHENTCPEAPGDDPGSEEAAPAPPQKTSALQRPYHCQVCGQDFLFTPTEVLRHRRQHV
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 130 mouse Dhx34.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 71723

Enviar uma mensagem


Dhx34 polyclonal antibody

Dhx34 polyclonal antibody