R3hdm1 polyclonal antibody
  • R3hdm1 polyclonal antibody

R3hdm1 polyclonal antibody

Ref: AB-PAB15706
R3hdm1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant R3hdm1.
Información adicional
Size 50 ug
Gene Name R3hdm1
Gene Alias R3hdm
Gene Description R3H domain 1 (binds single-stranded nucleic acids)
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0379. This antibody detects mR3HDM1 protein.
Application Key WB
Immunogen Prot. Seq YPLLGQPLQYNPPTLLHGHIPHQQGQSGSRHGNRGRRQAKKAASTDLGAGEAVVGKVLEITELPDGITRVEAEKLFGELFKIGAKIRWLRDPQSQPQLRRHALCCGSGDNTVNPEHSKPSDLASTYTVLATFPSISAAQSALKKQIHSVNKFKLRMSKKHYDFHILERASSQ
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 172 mouse R3hdm1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 226412

Enviar uma mensagem


R3hdm1 polyclonal antibody

R3hdm1 polyclonal antibody