Gramd1b polyclonal antibody
  • Gramd1b polyclonal antibody

Gramd1b polyclonal antibody

Ref: AB-PAB15705
Gramd1b polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Gramd1b.
Información adicional
Size 100 ug
Gene Name Gramd1b
Gene Alias 3222402H23|A930008A22Rik|AI593249|KIAA1201|mKIAA1201
Gene Description GRAM domain containing 1B
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0439. This antibody detects endogenous mGRAMD1B protein in cerebellar interneuron cells.
Application Key WB,IHC
Immunogen Prot. Seq CEEIPIEENEVNDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLPLEEEVMEGDGSLEKELAIDNIIGEKIEIMAPVTSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFLRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTEL
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 370 mouse Gramd1b.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 235283

Enviar uma mensagem


Gramd1b polyclonal antibody

Gramd1b polyclonal antibody