Fbxw11 polyclonal antibody
  • Fbxw11 polyclonal antibody

Fbxw11 polyclonal antibody

Ref: AB-PAB15704
Fbxw11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Fbxw11.
Información adicional
Size 100 ug
Gene Name Fbxw11
Gene Alias 2310065A07Rik|AA536858|BTRC2|BTRCP2|Fbxw1b|HOS|mKIAA0696
Gene Description F-box and WD-40 domain protein 11
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0195. This antibody detects endogenous mFBXW11 protein in cerebellar purkinje and molecular layer cells.
Application Key WB,IHC
Immunogen Prot. Seq CLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 108 mouse Fbxw11.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 103583

Enviar uma mensagem


Fbxw11 polyclonal antibody

Fbxw11 polyclonal antibody