Fnbp1 polyclonal antibody
  • Fnbp1 polyclonal antibody

Fnbp1 polyclonal antibody

Ref: AB-PAB15703
Fnbp1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Fnbp1.
Información adicional
Size 100 ug
Gene Name Fnbp1
Gene Alias 1110057E06Rik|2210010H06Rik|FBP1|Fbp17
Gene Description formin binding protein 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0310. This antibody detects endogenous mFNBP1 protein in cerebellar bergmann glia cells.
Application Key IHC
Immunogen Prot. Seq QRFNQEQWEYYHTHIPNIFQKIQEMEERRIVRIGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVVEAYKSGFEPPGDIEFEDYTQPMKRTVSDNSLSSSKEGKPELRFGGKSRGKLWPFIKKNKLMSLLTSPHQ
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 144 mouse Fnbp1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 14269

Enviar uma mensagem


Fnbp1 polyclonal antibody

Fnbp1 polyclonal antibody