Kcnd2 polyclonal antibody
  • Kcnd2 polyclonal antibody

Kcnd2 polyclonal antibody

Ref: AB-PAB15702
Kcnd2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Kcnd2 (Cerebellum, Granule cell).
Información adicional
Size 100 ug
Gene Name Kcnd2
Gene Alias AI839615|AW555701|Kv4.2|R75121|mKIAA1044
Gene Description potassium voltage-gated channel, Shal-related family, member 2
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GXD01. This antibody detects endogenous mKCND2 protein in cerebellar granule cells.
Application Key IHC
Immunogen Prot. Seq YMQSKRNGLLSNQLQSSEDEPAFISKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHRPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 187 mouse Kcnd2.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 16508

Enviar uma mensagem


Kcnd2 polyclonal antibody

Kcnd2 polyclonal antibody