Erc2 polyclonal antibody
  • Erc2 polyclonal antibody

Erc2 polyclonal antibody

Ref: AB-PAB15701
Erc2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant mouse Erc2.
Información adicional
Size 100 ug
Gene Name Erc2
Gene Alias 6430531D06|CAST|CAST1/ERC2|D14Ertd171e
Gene Description ELKS/RAB6-interacting/CAST family member 2
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0090. This antibody detects endogenous mERC2 protein in cerebellar purkinje cells.
Application Key IHC
Immunogen Prot. Seq LMNALEKTRQELDATKARLASTQQSLAEKEAHLANLRIERRKQLEEILEMKQEALLAAISEKDANIALLELSASKKKKTQEEVMALKREKDRLVHQLKQQTQNRMKLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQDDEEGIWA
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 153 mouse Erc2.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 238988

Enviar uma mensagem


Erc2 polyclonal antibody

Erc2 polyclonal antibody