Hspa4 polyclonal antibody
  • Hspa4 polyclonal antibody

Hspa4 polyclonal antibody

Ref: AB-PAB15700
Hspa4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Hspa4.
Información adicional
Size 100 ug
Gene Name Hspa4
Gene Alias 70kDa|AI317151|APG-2|Hsp110|Hsp70RY|KIAA4025|mKIAA4025
Gene Description heat shock protein 4
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0631. This antibody detects endogenous mHSPA4 protein in several cell types. It also recognizes human HSPA4 protein.
Application Key WB
Immunogen Prot. Seq LNLQNKQSLTVDPVVKTKEIEAKIKELTSICSPIISKPKPKVEPPKEEPKHAEQNGPVDGQGDNPGSQAAEHGADTAVPSDGDKKLPEMDID
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 92 mouse Hspa4.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 15525

Enviar uma mensagem


Hspa4 polyclonal antibody

Hspa4 polyclonal antibody