Kif21a polyclonal antibody
  • Kif21a polyclonal antibody

Kif21a polyclonal antibody

Ref: AB-PAB15699
Kif21a polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Kif21a.
Información adicional
Size 100 ug
Gene Name Kif21a
Gene Alias AI850764|mKIAA1708
Gene Description kinesin family member 21A
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0999. This antibody detects endogenous KIF21A protein in several cell types.
Application Key WB,IHC
Immunogen Prot. Seq YQRKGFTGRVFTSKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLRQREELTKRREKLSKRREKIVKESGEGDKSVANIIEEMESLTANIDYINDSIADCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDGAPPENEEDSSEEDGPLHSPGSEGSTLSSDLMKLCGEVKPKNKARRRTT
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 286 mouse Kif21a.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 16564

Enviar uma mensagem


Kif21a polyclonal antibody

Kif21a polyclonal antibody