Rrbp1 polyclonal antibody
  • Rrbp1 polyclonal antibody

Rrbp1 polyclonal antibody

Ref: AB-PAB15696
Rrbp1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Rrbp1.
Información adicional
Size 100 ug
Gene Name Rrbp1
Gene Alias 1700087N07Rik|5730465C04Rik|ES/130|mKIAA1398|mRRp0|mRRp1.8|mRRp10|mRRp15a|mRRp15b|mRRp16.8|mRRp2|mRRp41|mRRp47|mRRp5.4|p180
Gene Description ribosome binding protein 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0745. This antibody detects endogenous mRRBP1 protein in several cell types.
Application Key WB
Immunogen Prot. Seq AVPPAEQDPMKLKTQLERTEATLEDEQTRRQKLTAEFEEAQRTACRIQEELEELRAASPLGSSAKEEVTQLKERLEKEKRLTSDLGRAAIKLQELLKTTQEQLTKEKDTVKKLQEQLGKAEDGSSSKEGTSV
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 132 mouse Rrbp1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 81910

Enviar uma mensagem


Rrbp1 polyclonal antibody

Rrbp1 polyclonal antibody