Klhl9 polyclonal antibody
  • Klhl9 polyclonal antibody

Klhl9 polyclonal antibody

Ref: AB-PAB15695
Klhl9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Klhl9.
Información adicional
Size 100 ug
Gene Name Klhl9
Gene Alias 8030469P05|C530050O22Rik|ENSMUSG00000070923|KIAA1354|mKIAA1354
Gene Description kelch-like 9 (Drosophila)
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX1017. This antibody detects endogenous mKLHL9 protein in several cell types.
Application Key WB
Immunogen Prot. Seq SEPHYGHAGTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 185 mouse Klhl9.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 242521

Enviar uma mensagem


Klhl9 polyclonal antibody

Klhl9 polyclonal antibody