Tln1 polyclonal antibody
  • Tln1 polyclonal antibody

Tln1 polyclonal antibody

Ref: AB-PAB15690
Tln1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Tln1.
Información adicional
Size 100 ug
Gene Name Tln1
Gene Alias Tln
Gene Description talin 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0347. This antibody detects endogenous mTLN1 protein in several cell types. It also recognizes human TLN1 protein.
Application Key WB
Immunogen Prot. Seq PASPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSL
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 156 mouse Tln1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 21894

Enviar uma mensagem


Tln1 polyclonal antibody

Tln1 polyclonal antibody