Ppfia3 polyclonal antibody
  • Ppfia3 polyclonal antibody

Ppfia3 polyclonal antibody

Ref: AB-PAB15689
Ppfia3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Ppfia3.
Información adicional
Size 100 ug
Gene Name Ppfia3
Gene Alias 2410127E16Rik
Gene Description protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX1885. This antibody detects endogenous mPPFIA3 protein in several cell types.
Application Key WB
Immunogen Prot. Seq DKTNHVSKEEAGVPRGEGPAVPGDTPPPTPRSARLERMAQALALQAGSPEDGAPPRGSESTPDSLHKAPKRKSIKSSIGRLFGKKEKGRMGPPGRESVSLAGTPSDETLATDPLGLAKLTGPGDKDRRNKRKHELLEEACRQGLPFAAWDG
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 151 mouse Ppfia3.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 76787

Enviar uma mensagem


Ppfia3 polyclonal antibody

Ppfia3 polyclonal antibody