Tsc1 polyclonal antibody
  • Tsc1 polyclonal antibody

Tsc1 polyclonal antibody

Ref: AB-PAB15687
Tsc1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Tsc1.
Información adicional
Size 100 ug
Gene Name Tsc1
Gene Alias hamartin|mKIAA0243
Gene Description tuberous sclerosis 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0974. This antibody detects endogenous mTSC1 protein in several cell types.
Application Key WB
Immunogen Prot. Seq KYLEDVKSQASGQLLAAESRYEAQRKITRVLELEILDLYGRLEKDGRLRKLEEDRAEAAEAAEERLDCCSDGCTDSLVGHNEEASGHNGETRTSRPGGTRASCGGRVTGGSSSSSSELSTPEKPPSQRFSSRWEPALGEPSSSIPTTVGSLPSSKSFLGMKARELFRNKSESQCDEDSVTMSSSSLSETLKTELGKDSGTENKTSLSLDAPHPSSPNSDNVGQLHIMDYNETHPEHS
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 237 mouse Tsc1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 64930

Enviar uma mensagem


Tsc1 polyclonal antibody

Tsc1 polyclonal antibody