Agrp polyclonal antibody
  • Agrp polyclonal antibody

Agrp polyclonal antibody

Ref: AB-PAB14305
Agrp polyclonal antibody

Información del producto

Agrp polyclonal antibody
Información adicional
Size 50 uL
Gene Name Agrp
Gene Alias Agrt|Art
Gene Description agouti related protein
Storage Conditions Store at 4C on dry atmosphere.After reconstitution with deionized water, store at -20C or lower.Aliquot to avoid repeated freezing and thawing.
Application Key IHC-Fr,IF
Immunogen Prot. Seq SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT
Form Lyophilized
Recomended Dilution Immunohistochemistry (1:2000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen A synthetic peptide (conjugated with carrier protein) corresponding to amino acids 82-131 of mouse Agrp.
Storage Buffer Lyophilized from PBS
Gene ID 11604

Enviar uma mensagem


Agrp polyclonal antibody

Agrp polyclonal antibody